PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_53086.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 150aa    MW: 17555.9 Da    PI: 9.4646
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_53086.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.96.4e-5691391129
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                   +ppGfrFhPtdeelv++yL+kkv++++++l +vik+vd+yk+ePwdL++      ++e+++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk+++
  MLOC_53086.1   9 VPPGFRFHPTDEELVDYYLRKKVASRRIDL-NVIKDVDLYKIEPWDLQEkcriGPEEEQSDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKPIY 104
                   69****************************.99**************95343322335669************************************ PP

           NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                   + k+ lvg++ktLv+ykgrap+g+k+dW+mheyrle
  MLOC_53086.1 105 A-KHCLVGMRKTLVYYKGRAPNGQKSDWIMHEYRLE 139
                   *.899*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-576143IPR003441NAC domain
PROSITE profilePS5100554.1119150IPR003441NAC domain
PfamPF023651.3E-2910138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MSGSTQPQVP PGFRFHPTDE ELVDYYLRKK VASRRIDLNV IKDVDLYKIE PWDLQEKCRI  60
GPEEEQSDWY FFSHKDKKYP TGTRTNRATA AGFWKATGRD KPIYAKHCLV GMRKTLVYYK  120
GRAPNGQKSD WIMHEYRLET NENGPPQVSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-5031389140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6934251e-163JQ693425.1 Brachypodium distachyon SWN4 (SWN4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001304791.11e-103NAC domain-containing protein 7-like
RefseqXP_014754958.11e-103PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9FWX24e-89NAC7_ARATH; NAC domain-containing protein 7
TrEMBLM0WN161e-111M0WN16_HORVD; Uncharacterized protein
TrEMBLM8ALU31e-109M8ALU3_TRIUA; NAC domain-containing protein 7
STRINGMLOC_53086.21e-107(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.16e-80NAC 007